Plant Transcription Factor Database
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID cra_locus_7663_iso_3
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
Family MYB
Protein Properties Length: 1720aa    MW: 185107 Da    PI: 5.3618
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
                                          SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
                      Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                                          +WT+eE e++ d  + +G++ +k+Ia+ +  ++t  +c+++++k
  cra_locus_7663_iso_3_len_5588_ver_3 823 PWTAEEKEIFMDKLATYGKD-FKKIASFLM-HKTTADCVEFYYK 864
                                          8*****************99.*********.***********98 PP

                                           SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
                      Myb_DNA-binding    3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45  
                                            WT eE  ++v+av  +G++ ++ I+r++  +R++ qc+ ++ 
  cra_locus_7663_iso_3_len_5588_ver_3 1042 DWTDEEKSIFVQAVSSYGKD-FTMISRCIR-TRSRDQCRVFFS 1082
                                           5*****************99.*********.********8776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129316.425819870IPR017884SANT domain
SMARTSM007171.9E-8820868IPR001005SANT/Myb domain
PfamPF002498.7E-7822864IPR001005SANT/Myb domain
PROSITE profilePS5129310.71310381089IPR017884SANT domain
SMARTSM007171.5E-810391087IPR001005SANT/Myb domain
PfamPF002498.9E-810421082IPR001005SANT/Myb domain
CDDcd001673.91E-710431081No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1720 aa     Download sequence    Send to blast
3D Structure ? help Back to Top
PDB ID Evalue Query Start Query End Hit Start Hit End Description
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010658422.10.0PREDICTED: uncharacterized protein LOC100240985 isoform X1
TrEMBLA0A068TU320.0A0A068TU32_COFCA; Uncharacterized protein
STRINGVIT_13s0019g04010.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number